PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo11G0064600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 234aa    MW: 25960 Da    PI: 6.2495
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo11G0064600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed++lv +++++G g+W++ +++ g+ R++k+c++rw +yl
  Spipo11G0064600 14 KGPWTAGEDQILVSYIQRYGHGNWRALPKHAGLLRCGKSCRLRWMNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding506.9e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +++++  lG++ W+tIa+ ++ gRt++++k+ w+++l
  Spipo11G0064600  67 RGNFTQEEEDAIIRLHGSLGNK-WSTIAAQLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129415.784961IPR017930Myb domain
SuperFamilySSF466899.73E-3111108IPR009057Homeodomain-like
SMARTSM007171.7E-131363IPR001005SANT/Myb domain
PfamPF002499.5E-161461IPR001005SANT/Myb domain
CDDcd001673.92E-101661No hitNo description
PROSITE profilePS5129425.34862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2665115IPR009057Homeodomain-like
SMARTSM007173.5E-1366114IPR001005SANT/Myb domain
PfamPF002496.1E-1467112IPR001005SANT/Myb domain
CDDcd001677.07E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGRAPCCESI GLKKGPWTAG EDQILVSYIQ RYGHGNWRAL PKHAGLLRCG KSCRLRWMNY  60
LRPDIKRGNF TQEEEDAIIR LHGSLGNKWS TIAAQLPGRT DNEIKNVWHT HLKKRARSNR  120
PQREEPVKES ATPWRSCSEL SSSTTTGSST ATGGASMNEG HTGSPPELLG MDEDDWWSEA  180
LSLDSSVTSL EFSDSSSSLL PFDRTDVSSG EDDKDFWMRV LMEVGGMPEL PSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKRARS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010920477.11e-82PREDICTED: myb-related protein Myb4
SwissprotQ7XBH41e-72MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLJ3LEY22e-81J3LEY2_ORYBR; Uncharacterized protein
STRINGOB02G31990.16e-81(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.19e-72myb domain protein 15